PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa11g011780.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 526aa    MW: 59246.6 Da    PI: 5.4259
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa11g011780.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B338.71.8e-1228912299
                    H.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3 22 faeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                    f+ +h       k l + d s r+W+vkl  ++++    l++GW++F+ ++g ++gD++vFk++g++    +v+v ++
  Csa11g011780.1 28 FLMNHT------KVLLISDASDRVWKVKL--DGGR----LADGWEKFAGEHGFRDGDVLVFKHHGDEVL--HVSVASR 91
                    554443......3477889**********..9998....***********************8876555..8887665 PP

2B366.83.2e-21166260298
                     EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                     ++  ++ ++l+++rl l++kf++ +g+  ++  ++ + +e+gr W++kl  + +sg +++++GW++F++ n+L++gDf+ Fkl +  ++++v+++
  Csa11g011780.1 166 ITGCVTRYSLSKDRLDLSRKFTAFFGEH-PKACEIDVINEQGRIWTMKLAKNTSSGVFYIRAGWEHFCSTNDLRQGDFCKFKLFQ-IGERPVLSL 258
                     55668899**************777433.45569***************88888888*************************977.556678777 PP

                     E- CS
              B3  97 fr 98 
                     + 
  Csa11g011780.1 259 CP 260
                     75 PP

3B367.51.9e-21295388799
                     .-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE......EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3   7 psdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliy....rkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                     +++   +g+l+lp +f++e+g++k++  +++l d++gr+W+ +l++    r+ s++++l+kGW+e+++ang+k++D++ ++l++ +++++++k++
  Csa11g011780.1 295 TPSRDYTGQLSLPVSFTRENGINKAG--DVILLDQDGRKWSSYLQItglgRGVSEWFYLRKGWREMCEANGVKVNDSFKLELMW-EGANPLFKFC 386
                     566667789**************888..7***************998999999999****************************.9999*****9 PP

                     -S CS
              B3  98 rk 99 
                     +k
  Csa11g011780.1 387 SK 388
                     87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086311.942792IPR003340B3 DNA binding domain
SMARTSM010191.5E-121092IPR003340B3 DNA binding domain
SuperFamilySSF1019361.43E-112790IPR015300DNA-binding pseudobarrel domain
CDDcd100171.36E-82888No hitNo description
Gene3DG3DSA:2.40.330.101.9E-113390IPR015300DNA-binding pseudobarrel domain
PfamPF023622.3E-73490IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.8E-16160261IPR015300DNA-binding pseudobarrel domain
PfamPF023627.7E-18165260IPR003340B3 DNA binding domain
SuperFamilySSF1019361.1E-18165262IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.3E-22165262IPR003340B3 DNA binding domain
PROSITE profilePS5086313.465165261IPR003340B3 DNA binding domain
CDDcd100173.27E-19175260No hitNo description
Gene3DG3DSA:2.40.330.101.0E-18284388IPR015300DNA-binding pseudobarrel domain
CDDcd100177.19E-16288387No hitNo description
PROSITE profilePS5086312.294289388IPR003340B3 DNA binding domain
SMARTSM010192.4E-23289389IPR003340B3 DNA binding domain
PfamPF023625.2E-22292388IPR003340B3 DNA binding domain
SuperFamilySSF1019361.06E-18292393IPR015300DNA-binding pseudobarrel domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009908Biological Processflower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 526 aa     Download sequence    Send to blast
MADPPHFSSF EHKFLTGDKP LLTLDADFLM NHTKVLLISD ASDRVWKVKL DGGRLADGWE  60
KFAGEHGFRD GDVLVFKHHG DEVLHVSVAS RSVSRDLHHA SSSHVDTEDT YIDNDDDDDD  120
DDDDDGKDDD DDDDDDDDDD DDDGAGERAT NKKPEADSSS GQSCFITGCV TRYSLSKDRL  180
DLSRKFTAFF GEHPKACEID VINEQGRIWT MKLAKNTSSG VFYIRAGWEH FCSTNDLRQG  240
DFCKFKLFQI GERPVLSLCP QESGNGHKEK RTLDEVSKRK EKKKAPSPTV IIKYTPSRDY  300
TGQLSLPVSF TRENGINKAG DVILLDQDGR KWSSYLQITG LGRGVSEWFY LRKGWREMCE  360
ANGVKVNDSF KLELMWEGAN PLFKFCSKIE NHEYKGKGNH TTRRKRACET APQPRNVRKT  420
PRVGVEGQVN KRISRGPEHQ VDEERGRTQV SNRTNTISRK FLSVQPQSCS VSDQVASVKQ  480
GIVDTLNTVR QCRTELETSE QNLQASLLAI DALGERIWEI SNDLV*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00602PBMTransfer from AT4G31610Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010438016.10.0PREDICTED: B3 domain-containing protein REM1-like
SwissprotQ84J390.0REM1_ARATH; B3 domain-containing protein REM1
TrEMBLR0F9690.0R0F969_9BRAS; Uncharacterized protein
STRINGAT4G31610.10.0(Arabidopsis thaliana)
STRINGfgenesh2_kg.7__1010__AT4G31610.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM99501736
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31610.10.0B3 family protein